PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C020648P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 341aa    MW: 37107.1 Da    PI: 9.7772
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C020648P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.7e-3985144362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     e+alkcprCdstntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nkk++
  MELO3C020648P1  85 ETALKCPRCDSTNTKFCYFNNYSLSQPRHFCKSCRRYWTRGGALRNVPVGGGCRRNKKNK 144
                     6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3368137IPR003851Zinc finger, Dof-type
PfamPF027017.3E-3387142IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.75888142IPR003851Zinc finger, Dof-type
PROSITE patternPS01361090126IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MDFSSVPIYL DPPPNWHHQQ SNHHHHHPQI SNSDGSPQHQ HLLSLPTQQL SSAPSSHVGV  60
GVGVGSIRRG SMADRARMAN VPLPETALKC PRCDSTNTKF CYFNNYSLSQ PRHFCKSCRR  120
YWTRGGALRN VPVGGGCRRN KKNKTRRSKS PTAAATMAGG NESQVMNNNS NSPTTATIPL  180
HSSAENLIGH LQPQHPHLSF MASLNNFSRF GTSSLGLNFN EIQTQTNNIG NGALLNHHPW  240
RSSQNFPLSG GLETPPGLYP FQISGGDNTT NSILTPISRG THLPPVKIEE TQVLNLLKSS  300
NLGINNSENN QFWSNASNGW TDLSAISSTS SGHISCDFNH *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819260.0LN681926.1 Cucumis melo genomic scaffold, anchoredscaffold00044.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008457487.10.0PREDICTED: dof zinc finger protein DOF3.6
TrEMBLA0A0A0LUU20.0A0A0A0LUU2_CUCSA; Uncharacterized protein
STRINGGLYMA12G06880.29e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.13e-43Dof family protein